Details from NCBI annotation

Gene Symbol unclassified transcription discrepancy
Gene Name mRNA
Entrez Gene ID 101704602

Database interlinks

Part of NW_004625012.1 (Scaffold)

For more information consult the page for NW_004625012.1 (Scaffold)

Potential Gene Matches

The following genes have been identified as possible homologs of the naked mole-rat gene and compared to it.

ENSCPOG00000026053 (Guinea pig)

Gene Details

Uncharacterized protein

External Links

Gene Match (Ensembl Protein ID: ENSCPOP00000020317, Guinea pig)

Protein Percentage 21.31%
CDS Percentage 36.07%
Ka/Ks Ratio 0.13711 (Ka = 1.429, Ks = 10.4222)

Spag11b ENSMUSG00000059463 (Mouse)

Gene Details

sperm associated antigen 11B

External Links

Gene Match (Ensembl Protein ID: ENSMUSP00000048125, Mouse)

Protein Percentage 23.44%
CDS Percentage 35.94%
Ka/Ks Ratio 0.08392 (Ka = 1.0351, Ks = 12.335)

Spag11bl ENSRNOG00000031111 (Rat)

Gene Details

sperm associated antigen 11C (Spag11c), transcript variant 1, mRNA

External Links

Gene Match (Ensembl Protein ID: ENSRNOP00000040559, Rat)

Protein Percentage 18.75%
CDS Percentage 36.46%
Ka/Ks Ratio 0.10101 (Ka = 1.132, Ks = 11.2073)

Genome Location

Sequence Coding sequence

Length: 201 bp    Location: 58042..59590   Strand: +
>XM_004921233.1
ATGAGGGGCATTTTGCTTTTTGCAGTTTGCTTCTGTTTAGTCCAAAGGAACACAGGAGACATTCCATTGGGAATTAGAAATACAATCTGCCTCATGCAAAGCAGGAGATGCNNACTTTTTTTCTGCCATGCTGGTGAGAAAAGAAGTGACATTTGCTCTGATCCCTGGAATAAGTCCTGTATACCAAACATAAAGGAATAA

Related Sequences

XP_004921290.1 Protein

unclassified transcription discrepancy PREDICTED: LOW QUALITY PROTEIN: sperm associated antigen 11B [Heterocephalus glaber]

Length: 66 aa     
>XP_004921290.1
MRGILLFAVCFCLVQRNTGDIPLGIRNTICLMQSRRCXLFFCHAGEKRSDICSDPWNKSCIPNIKE