Details from NCBI annotation

Gene Symbol Ghrh
Gene Name growth hormone releasing hormone
Entrez Gene ID 101703645

This gene is present in the GenAge database and has been identified as potentially important to ageing in humans.

Database interlinks

Part of NW_004625146.1 (SequenceType object (1))

For more information consult the page for NW_004625146.1 (SequenceType object (1))

Potential Gene Matches

The following genes have been identified as possible homologs of the naked mole-rat gene and compared to it.

GHRHENSCPOG00000020252 (Guinea pig)

Gene Details

growth hormone releasing hormone

External Links

Gene Match(Ensembl Protein ID:ENSCPOP00000014639, Guinea pig)

Protein Percentage 81.55%
CDS Percentage 88.03%
Ka/Ks Ratio 0.27399 (Ka = 0.0981, Ks = 0.3582)

GHRHENSG00000118702 (Human)

Gene Details

growth hormone releasing hormone

External Links

Gene Match(Ensembl Protein ID:ENSP00000362716, Human)

Protein Percentage 81.55%
CDS Percentage 89.0%
Ka/Ks Ratio 0.37906 (Ka = 0.0972, Ks = 0.2564)

GhrhENSMUSG00000027643 (Mouse)

Gene Details

growth hormone releasing hormone

External Links

Gene Match(Ensembl Protein ID:ENSMUSP00000029172, Mouse)

Protein Percentage 61.62%
CDS Percentage 73.06%
Ka/Ks Ratio 0.14166 (Ka = 0.2312, Ks = 1.6324)

GhrhENSRNOG00000007782 (Rat)

Gene Details

growth hormone releasing hormone (Ghrh), mRNA

External Links

Gene Match(Ensembl Protein ID:ENSRNOP00000010298, Rat)

Protein Percentage 66.0%
CDS Percentage 73.33%
Ka/Ks Ratio 0.12522 (Ka = 0.2016, Ks = 1.6103)

Genome Location

Sequence SequenceType object (2)

Length: 312 bp    Location: 13318..6381   Strand: -
>XM_004875526.1
ATGCCACTCTGGGTGTTCTTCTTCGTGATCCTCACCCTCAGCAGCAGCTCCCACTGCTCCTCACCTGTCTCCCTGCCCCTCAGGATGCGGCGGTACGCAGATGCCATCTTCACCAACAGCTACCGGAAGGTGTTGAGCCAGCTGTCTGCCCGCAAGCTGCTCCAGGACATCATGAACCGGCAGCAGGGAAAGAGGAACCAGGAGCAAGGAGCAAGGATACGGCTTGGCCGTCAGCTGGACAGCATGTGGACAGACCAAAACCAGGTAGCATTGGAAAGCATGCTGGTGGCCCTGCTGCAGAAGCACAGGTAG

Related Sequences

XP_004875583.1 SequenceType object (4)

Ghrh PREDICTED: somatoliberin-like [Heterocephalus glaber]

Length: 103 aa      View alignments
>XP_004875583.1
MPLWVFFFVILTLSSSSHCSSPVSLPLRMRRYADAIFTNSYRKVLSQLSARKLLQDIMNRQQGKRNQEQGARIRLGRQLDSMWTDQNQVALESMLVALLQKHR