Details from NCBI annotation

Gene Symbol Nrgn
Gene Name neurogranin (protein kinase C substrate, RC3), transcript variant X2
Entrez Gene ID 101719402

Database interlinks

Part of NW_004624927.1 (Scaffold)

For more information consult the page for NW_004624927.1 (Scaffold)

Potential Gene Matches

The following genes have been identified as possible homologs of the naked mole-rat gene and compared to it.

NRGN ENSCPOG00000000600 (Guinea pig)

Gene Details

neurogranin (protein kinase C substrate, RC3)

External Links

Gene Match (Ensembl Protein ID: ENSCPOP00000000529, Guinea pig)

Protein Percentage 73.33%
CDS Percentage 76.89%
Ka/Ks Ratio 0.2485 (Ka = 0.186, Ks = 0.7487)

NRGN ENSG00000154146 (Human)

Gene Details

neurogranin (protein kinase C substrate, RC3)

External Links

Gene Match (Ensembl Protein ID: ENSP00000284292, Human)

Protein Percentage 92.31%
CDS Percentage 91.45%
Ka/Ks Ratio 0.09623 (Ka = 0.0357, Ks = 0.3712)

Nrgn ENSMUSG00000053310 (Mouse)

Gene Details

neurogranin

External Links

Gene Match (Ensembl Protein ID: ENSMUSP00000070113, Mouse)

Protein Percentage 93.59%
CDS Percentage 90.17%
Ka/Ks Ratio 0.06717 (Ka = 0.0305, Ks = 0.4535)

Nrgn ENSRNOG00000010688 (Rat)

Gene Details

neurogranin (Nrgn), mRNA

External Links

Gene Match (Ensembl Protein ID: ENSRNOP00000014404, Rat)

Protein Percentage 93.59%
CDS Percentage 89.32%
Ka/Ks Ratio 0.05991 (Ka = 0.0311, Ks = 0.5191)

Genome Location

Sequence Coding sequence

Length: 237 bp    Location: 753949..762663   Strand: +
>XM_004874462.1
ATGGACTGCTGCACTGAAAGCGCCTGCTCCAAGCCGGAAGACGACATTCTAGACATCCCGCTGGACGATCCTGGTGCCAATGCGGCCGCTGCCAAAATCCAGGCGAGTTTCCGGGGCCACATGGCGCGGAAGAAGATAAAGAGTGGAGAGCGCAGCCGGAAGGGCCCGGGCCTCGGGGGACCAGGCGGAGCTGGGGGCGCCCGGGTTGGCGCGGGCGGCGGCCCCAGCGGTGACTAG

Related Sequences

XP_004874519.1 Protein

Nrgn PREDICTED: proline-rich protein 12 isoform X2 [Heterocephalus glaber]

Length: 78 aa      View alignments
>XP_004874519.1
MDCCTESACSKPEDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERSRKGPGLGGPGGAGGARVGAGGGPSGD