Details from NCBI annotation

Gene Symbol Gng3
Gene Name guanine nucleotide binding protein (G protein), gamma 3
Entrez Gene ID 101726057

Database interlinks

Part of NW_004624926.1 (SequenceType object (1))

For more information consult the page for NW_004624926.1 (SequenceType object (1))

Potential Gene Matches

The following genes have been identified as possible homologs of the naked mole-rat gene and compared to it.

GNG3ENSCPOG00000026902 (Guinea pig)

Gene Details

guanine nucleotide binding protein (G protein), gamma 3

External Links

Gene Match(Ensembl Protein ID:ENSCPOP00000018171, Guinea pig)

Protein Percentage 100.0%
CDS Percentage 91.56%
Ka/Ks Ratio 0.001 (Ka = 0.0019, Ks = 1.9414)

GNG3ENSG00000162188 (Human)

Gene Details

guanine nucleotide binding protein (G protein), gamma 3

External Links

Gene Match(Ensembl Protein ID:ENSP00000294117, Human)

Protein Percentage 100.0%
CDS Percentage 86.67%
Ka/Ks Ratio 0.001 (Ka = 0.0018, Ks = 1.8091)

Gng3ENSMUSG00000071658 (Mouse)

Gene Details

guanine nucleotide binding protein (G protein), gamma 3

External Links

Gene Match(Ensembl Protein ID:ENSMUSP00000093978, Mouse)

Protein Percentage 100.0%
CDS Percentage 87.56%
Ka/Ks Ratio 0.001 (Ka = 0.0015, Ks = 1.5108)

Gng3ENSRNOG00000019570 (Rat)

Gene Details

guanine nucleotide binding protein (G protein), gamma 3 (Gng3), mRNA

External Links

Gene Match(Ensembl Protein ID:ENSRNOP00000026539, Rat)

Protein Percentage 100.0%
CDS Percentage 87.56%
Ka/Ks Ratio 0.001 (Ka = 0.0015, Ks = 1.499)

Genome Location

Sequence SequenceType object (2)

Length: 228 bp    Location: 1197591..1198601   Strand: +
>XM_004874394.1
ATGAAGGGGGAGACACCCGTGAACAGCACTATGAGCATCGGGCAGGCGCGCAAGATGGTGGAGCAGCTGAAGATCGAGGCCAGCCTGTGCCGGATAAAGGTGTCCAAGGCTGCAGCGGACTTGATGACGTACTGTGACGCCCACGCCTGCGAGGACCCGCTCATCACGCCGGTGCCCACCTCGGAGAACCCCTTCCGCGAGAAGAAGTTTTTCTGTGCGCTGCTGTGA

Related Sequences

XP_004874451.1 SequenceType object (4)

Gng3 PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3 [Heterocephalus glaber]

Length: 75 aa      View alignments
>XP_004874451.1
MKGETPVNSTMSIGQARKMVEQLKIEASLCRIKVSKAAADLMTYCDAHACEDPLITPVPTSENPFREKKFFCALL