Sequence details NCBI ID: XM_004871007.1 (Coding sequence)   Best Hit

Details from NCBI annotation

Gene Symbol Tmsb4x
Gene Name thymosin beta 4, X-linked
Entrez Gene ID 101726037

Database interlinks

Part of NW_004624882.1 (Scaffold)

For more information consult the page for NW_004624882.1 (Scaffold)

Potential Gene Matches

The following genes have been identified as possible homologs of the naked mole-rat gene and compared to it.

ENSCPOG00000006450 (Guinea pig)

Gene Details

Uncharacterized protein

External Links

Gene Match (Ensembl Protein ID: ENSCPOP00000005810, Guinea pig)

Protein Percentage 82.5%
CDS Percentage 85.83%
Ka/Ks Ratio 0.57702 (Ka = 0.1512, Ks = 0.262)

Genome Location

Sequence Coding sequence

Length: 135 bp    Location: 1200201..1198099   Strand: -
Raw sequence   
>XM_004871007.1
ATGTCTGACAAACCCGATATGGCTGAGATCGAGAAATTCGATAAGTCGAAATTGAAGAAGACAGAAACGCAAGAGAAAAATCCTCTGCCTTCGAAAGAAACGATTGAACAAGAGAAGCAAGCAGGCGAATCGTAA

Related Sequences

XP_004871064.1 Protein

Tmsb4x PREDICTED: thymosin beta-4 [Heterocephalus glaber]

Length: 44 aa      
>XP_004871064.1
MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES