Sequence details NCBI ID: XM_004869592.1 (Coding sequence)   Best Hit

Details from NCBI annotation

Gene Symbol Defb1
Gene Name defensin, beta 1
Entrez Gene ID 101713234

Database interlinks

Part of NW_004624861.1 (Scaffold)

For more information consult the page for NW_004624861.1 (Scaffold)

Potential Gene Matches

The following genes have been identified as possible homologs of the naked mole-rat gene and compared to it.

DEFB1 ENSCPOG00000008709 (Guinea pig)

Gene Details

defensin, beta 1

External Links

Gene Match (Ensembl Protein ID: ENSCPOP00000007818, Guinea pig)

Protein Percentage 82.61%
CDS Percentage 80.43%
Ka/Ks Ratio 0.04177 (Ka = 0.0922, Ks = 2.2067)

DEFB1 ENSG00000164825 (Human)

Gene Details

defensin, beta 1

External Links

Gene Match (Ensembl Protein ID: ENSP00000297439, Human)

Protein Percentage 64.18%
CDS Percentage 71.14%
Ka/Ks Ratio 0.24508 (Ka = 0.2573, Ks = 1.0498)

Defb1 ENSMUSG00000044748 (Mouse)

Gene Details

defensin beta 1

External Links

Gene Match (Ensembl Protein ID: ENSMUSP00000051754, Mouse)

Protein Percentage 53.73%
CDS Percentage 64.18%
Ka/Ks Ratio 0.15525 (Ka = 0.3065, Ks = 1.9741)

Defb1 ENSRNOG00000013768 (Rat)

Gene Details

defensin beta 1 (Defb1), mRNA

External Links

Gene Match (Ensembl Protein ID: ENSRNOP00000018428, Rat)

Protein Percentage 52.24%
CDS Percentage 64.18%
Ka/Ks Ratio 0.17158 (Ka = 0.3232, Ks = 1.8837)

Genome Location

Sequence Coding sequence

Length: 204 bp    Location: 4718648..4710687   Strand: -
Raw sequence   
>XM_004869592.1
ATGAGGACCCACTGCCTGCTGCTGCTCACCATCTGCTTCCTCTCCTTCCACACGGCCCCAGGGGCTGGTCTCACAAGTCTTGGCCACCGACCAGACCACTACCAATGTGTGAAGAATGGGGGATTCTGTCTCTACTCTGCCTGCCCCGTGTACTCCAAAATTGTCGGCACCTGCTACAGTGGGAAGGCCAAGTGCTGCACCTGA

Related Sequences

XP_004869649.1 Protein

Defb1 PREDICTED: beta-defensin 1 [Heterocephalus glaber]

Length: 67 aa      View alignments
>XP_004869649.1
MRTHCLLLLTICFLSFHTAPGAGLTSLGHRPDHYQCVKNGGFCLYSACPVYSKIVGTCYSGKAKCCT