Sequence details NCBI ID: XM_004864986.1 (Coding sequence)   Best Hit

Details from NCBI annotation

Gene Symbol Nop10
Gene Name NOP10 ribonucleoprotein
Entrez Gene ID 101703459

Database interlinks

Part of NW_004624825.1 (Scaffold)

For more information consult the page for NW_004624825.1 (Scaffold)

Potential Gene Matches

The following genes have been identified as possible homologs of the naked mole-rat gene and compared to it.

NOP10 ENSCPOG00000007952 (Guinea pig)

Gene Details

NOP10 ribonucleoprotein

External Links

Gene Match (Ensembl Protein ID: ENSCPOP00000007156, Guinea pig)

Protein Percentage 95.31%
CDS Percentage 93.75%
Ka/Ks Ratio 0.0744 (Ka = 0.0201, Ks = 0.2706)

NOP10 ENSG00000182117 (Human)

Gene Details

NOP10 ribonucleoprotein

External Links

Gene Match (Ensembl Protein ID: ENSP00000332198, Human)

Protein Percentage 96.88%
CDS Percentage 93.23%
Ka/Ks Ratio 0.0389 (Ka = 0.0134, Ks = 0.3444)

Nop10 ENSMUSG00000027133 (Mouse)

Gene Details

NOP10 ribonucleoprotein

External Links

Gene Match (Ensembl Protein ID: ENSMUSP00000028553, Mouse)

Protein Percentage 96.88%
CDS Percentage 90.1%
Ka/Ks Ratio 0.0192 (Ka = 0.0131, Ks = 0.6822)

Nop10 ENSRNOG00000005184 (Rat)

Gene Details

NOP10 ribonucleoprotein (Nop10), mRNA

External Links

Gene Match (Ensembl Protein ID: ENSRNOP00000006887, Rat)

Protein Percentage 96.88%
CDS Percentage 90.1%
Ka/Ks Ratio 0.01516 (Ka = 0.0128, Ks = 0.8442)

Genome Location

Sequence Coding sequence

Length: 195 bp    Location: 4126188..4125455   Strand: -
Raw sequence   
>XM_004864986.1
ATGTTTCTCCAGTATTTCTTGAACGAGCAGGGAGATCGGGTGTATACGCTGAAGAAATTTGACCCGATGGGACAACAGACTTGCTCAGCCCATCCTGCTCGGTTCTCCCCGGACGACAAATACTCGCGACACCGAATCACCATCAAGAAGCGCTTCAAGGTGCTCATGACCCAGCTGCCGCGCCCGGTCCTCTGA

Related Sequences

XP_004865043.1 Protein

Nop10 PREDICTED: H/ACA ribonucleoprotein complex subunit 3 [Heterocephalus glaber]

Length: 64 aa      View alignments
>XP_004865043.1
MFLQYFLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKKRFKVLMTQLPRPVL