Details from NCBI annotation

Gene Symbol Nedd8
Gene Name neural precursor cell expressed, developmentally down-regulated 8
Entrez Gene ID 101698441

Database interlinks

Part of NW_004624820.1 (Scaffold)

For more information consult the page for NW_004624820.1 (Scaffold)

Potential Gene Matches

The following genes have been identified as possible homologs of the naked mole-rat gene and compared to it.

NEDD8 ENSCPOG00000010930 (Guinea pig)

Gene Details

neural precursor cell expressed, developmentally down-regulated 8

External Links

Gene Match (Ensembl Protein ID: ENSCPOP00000009821, Guinea pig)

Protein Percentage 95.06%
CDS Percentage 90.53%
Ka/Ks Ratio 0.06838 (Ka = 0.0282, Ks = 0.4131)

NEDD8 ENSG00000129559 (Human)

Gene Details

neural precursor cell expressed, developmentally down-regulated 8

External Links

Gene Match (Ensembl Protein ID: ENSP00000250495, Human)

Protein Percentage 100.0%
CDS Percentage 92.59%
Ka/Ks Ratio 0.001 (Ka = 0.0004, Ks = 0.3699)

Nedd8 ENSMUSG00000010376 (Mouse)

Gene Details

neural precursor cell expressed, developmentally down-regulated gene 8

External Links

Gene Match (Ensembl Protein ID: ENSMUSP00000010520, Mouse)

Protein Percentage 98.77%
CDS Percentage 90.12%
Ka/Ks Ratio 0.01204 (Ka = 0.0058, Ks = 0.4817)

Nedd8 ENSRNOG00000019895 (Rat)

Gene Details

neural precursor cell expressed, developmentally down-regulated 8 (Nedd8), mRNA

External Links

Gene Match (Ensembl Protein ID: ENSRNOP00000061284, Rat)

Protein Percentage 98.77%
CDS Percentage 91.36%
Ka/Ks Ratio 0.01569 (Ka = 0.0059, Ks = 0.3745)

Genome Location

Sequence Coding sequence

Length: 246 bp    Location: 8319853..8329744   Strand: +
>XM_004864113.1
ATGCTAATTAAAGTGAAGACACTGACTGGAAAGGAGATTGAAATTGACATTGAACCCACAGATAAGGTGGAGCGAATCAAGGAGCGAGTGGAGGAGAAAGAGGGAATCCCACCACAGCAACAGCGGCTCATCTACAGTGGCAAACAGATGAATGATGAGAAGACAGCAGCTGACTACAAGATTCTAGGCGGTTCTGTCCTCCACCTGGTGTTGGCACTGAGAGGAGGAGGTGGTCTTAGGCAATGA

Related Sequences

XP_004864170.1 Protein

Nedd8 PREDICTED: NEDD8 [Heterocephalus glaber]

Length: 81 aa      View alignments
>XP_004864170.1
MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGGGGLRQ