Sequence details NCBI ID: XM_004860163.1 (Coding sequence)   Best Hit

Details from NCBI annotation

Gene Symbol Pln
Gene Name phospholamban
Entrez Gene ID 101699885

Database interlinks

Part of NW_004624798.1 (Scaffold)

For more information consult the page for NW_004624798.1 (Scaffold)

Potential Gene Matches

The following genes have been identified as possible homologs of the naked mole-rat gene and compared to it.

PLN ENSCPOG00000025178 (Guinea pig)

Gene Details

phospholamban

External Links

Gene Match (Ensembl Protein ID: ENSCPOP00000014444, Guinea pig)

Protein Percentage 96.15%
CDS Percentage 94.23%
Ka/Ks Ratio 0.00657 (Ka = 0.0157, Ks = 2.3949)

PLN ENSG00000198523 (Human)

Gene Details

phospholamban

External Links

Gene Match (Ensembl Protein ID: ENSP00000350132, Human)

Protein Percentage 96.15%
CDS Percentage 76.28%
Ka/Ks Ratio 0.0029 (Ka = 0.0195, Ks = 6.7145)

Pln ENSMUSG00000038583 (Mouse)

Gene Details

phospholamban

External Links

Gene Match (Ensembl Protein ID: ENSMUSP00000132743, Mouse)

Protein Percentage 98.08%
CDS Percentage 80.13%
Ka/Ks Ratio 0.001 (Ka = 0.0116, Ks = 11.6326)

Pln ENSRNOG00000000413 (Rat)

Gene Details

phospholamban (Pln), mRNA

External Links

Gene Match (Ensembl Protein ID: ENSRNOP00000000469, Rat)

Protein Percentage 98.08%
CDS Percentage 82.05%
Ka/Ks Ratio 0.00103 (Ka = 0.0094, Ks = 9.1867)

Genome Location

Sequence Coding sequence

Length: 159 bp    Location: 11528777..11522260   Strand: -
Raw sequence   
>XM_004860163.1
ATGGAGAAGGTGCAGTACCTGACGCGCTCAGCCATCCGGAGGGCCTCGGCCATCGAGATGCCCCAGCAGGCGCGCCAGAACCTCCAGAACCTCTTCATCAACTTCTGCCTCATCCTCATCTGCCTGCTGCTCATCTGCATCATCGTCATGCTGCTCTGA

Related Sequences

XP_004860220.1 Protein

Pln PREDICTED: cardiac phospholamban [Heterocephalus glaber]

Length: 52 aa      View alignments
>XP_004860220.1
MEKVQYLTRSAIRRASAIEMPQQARQNLQNLFINFCLILICLLLICIIVMLL