Details from NCBI annotation

Gene Symbol Pkib
Gene Name protein kinase (cAMP-dependent, catalytic) inhibitor beta, transcript variant X5
Entrez Gene ID 101722377

Database interlinks

Part of NW_004624798.1 (Scaffold)

For more information consult the page for NW_004624798.1 (Scaffold)

Potential Gene Matches

The following genes have been identified as possible homologs of the naked mole-rat gene and compared to it.

PKIB ENSCPOG00000014055 (Guinea pig)

Gene Details

protein kinase (cAMP-dependent, catalytic) inhibitor beta

External Links

Gene Match (Ensembl Protein ID: ENSCPOP00000012658, Guinea pig)

Protein Percentage 54.32%
CDS Percentage 67.9%
Ka/Ks Ratio 0.33434 (Ka = 0.3396, Ks = 1.0158)

PKIB ENSG00000135549 (Human)

Gene Details

protein kinase (cAMP-dependent, catalytic) inhibitor beta

External Links

Gene Match (Ensembl Protein ID: ENSP00000258014, Human)

Protein Percentage 48.19%
CDS Percentage 59.44%
Ka/Ks Ratio 0.11189 (Ka = 0.4255, Ks = 3.8031)

Pkib ENSMUSG00000019876 (Mouse)

Gene Details

protein kinase inhibitor beta, cAMP dependent, testis specific

External Links

Gene Match (Ensembl Protein ID: ENSMUSP00000093329, Mouse)

Protein Percentage 38.3%
CDS Percentage 51.77%
Ka/Ks Ratio 0.05352 (Ka = 0.5861, Ks = 10.9501)

Pkib ENSRNOG00000000811 (Rat)

Gene Details

protein kinase (cAMP-dependent, catalytic) inhibitor beta (Pkib), transcript variant 2, mRNA

External Links

Gene Match (Ensembl Protein ID: ENSRNOP00000001075, Rat)

Protein Percentage 40.21%
CDS Percentage 53.61%
Ka/Ks Ratio 0.0372 (Ka = 0.5536, Ks = 14.8799)

Genome Location

Sequence Coding sequence

Length: 294 bp    Location: 8544273..8459808   Strand: -
>XM_004860149.1
ATGTCTGTGCTGTCCACTGAGAAAGAAAATCCAGGAGACAGGTTCCTAAAGGAAGACCCGGCCATGAGGACGCGCTCCCCCACCCGGCCCGACCCGGAGCCCGCGCTCTCCAGCTTCGCCGCCTCCTCGCGCAGCGGCCGGCGCAACGCCCTGCCCGACATCCTGGGCGCGGACGCCAGCGCCTGCGAGGAGCTGCCGCCGCCGCGGAGCCTCTCGGTGAAGGAAGATGTGCAACAGAAGAGCGAAGCAGCAGCACGAGACCGGTTGGGAAATCCCAGAGAGGAAGAGAAATGA

Related Sequences

XP_004860206.1 Protein

Pkib PREDICTED: cAMP-dependent protein kinase inhibitor beta isoform X5 [Heterocephalus glaber]

Length: 97 aa      View alignments
>XP_004860206.1
MSVLSTEKENPGDRFLKEDPAMRTRSPTRPDPEPALSSFAASSRSGRRNALPDILGADASACEELPPPRSLSVKEDVQQKSEAAARDRLGNPREEEK