Details from NCBI annotation

Gene Symbol Fcer1g
Gene Name Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide
Entrez Gene ID 101702022

Database interlinks

Part of NW_004624794.1 (Scaffold)

For more information consult the page for NW_004624794.1 (Scaffold)

Potential Gene Matches

The following genes have been identified as possible homologs of the naked mole-rat gene and compared to it.

FCER1G ENSCPOG00000015327 (Guinea pig)

Gene Details

Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide

External Links

Gene Match (Ensembl Protein ID: ENSCPOP00000013813, Guinea pig)

Protein Percentage 94.19%
CDS Percentage 95.74%
Ka/Ks Ratio 0.37747 (Ka = 0.0296, Ks = 0.0783)

FCER1G ENSG00000158869 (Human)

Gene Details

Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide

External Links

Gene Match (Ensembl Protein ID: ENSP00000289902, Human)

Protein Percentage 93.02%
CDS Percentage 90.31%
Ka/Ks Ratio 0.10993 (Ka = 0.0346, Ks = 0.3149)

Fcer1g ENSMUSG00000058715 (Mouse)

Gene Details

Fc receptor, IgE, high affinity I, gamma polypeptide

External Links

Gene Match (Ensembl Protein ID: ENSMUSP00000078875, Mouse)

Protein Percentage 86.05%
CDS Percentage 85.66%
Ka/Ks Ratio 0.18567 (Ka = 0.0795, Ks = 0.4283)

Fcer1g ENSRNOG00000024159 (Rat)

Gene Details

Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide (Fcer1g), mRNA

External Links

Gene Match (Ensembl Protein ID: ENSRNOP00000036716, Rat)

Protein Percentage 88.37%
CDS Percentage 85.66%
Ka/Ks Ratio 0.13936 (Ka = 0.0663, Ks = 0.4754)

Genome Location

Sequence Coding sequence

Length: 264 bp    Location: 172061..168556   Strand: -
>XM_004858663.1
ATGATGTTTCCAGCAGTGCTCTTACTCTTACTCCTTTTGGTTGAACAAGCAGCGGCCCTGGGGGAGCCTCAGCTCTGCTATATCCTGGATGCCATCTTGTTCTTGTATGGTATAATCCTGACTCTGCTCTATTGTCGACTCAAGATCCAAGTGCGAAAGGCAGCTATAGCCAGCTTTGAGAAATCAGATGGCATTTACACGGGCCTGAGCACCCGGAACCAGGAGACTTATGAAACACTGAAGCATGAGAAGCCACCCCAGTAA

Related Sequences

XP_004858720.1 Protein

Fcer1g PREDICTED: high affinity immunoglobulin epsilon receptor subunit gamma [Heterocephalus glaber]

Length: 87 aa      View alignments
>XP_004858720.1
MMFPAVLLLLLLLVEQAAALGEPQLCYILDAILFLYGIILTLLYCRLKIQVRKAAIASFEKSDGIYTGLSTRNQETYETLKHEKPPQ