Details from NCBI annotation

Gene Symbol Wfdc9
Gene Name WAP four-disulfide core domain 9
Entrez Gene ID 101704856

Database interlinks

Part of NW_004624790.1 (Scaffold)

For more information consult the page for NW_004624790.1 (Scaffold)

Potential Gene Matches

The following genes have been identified as possible homologs of the naked mole-rat gene and compared to it.

WFDC9 ENSCPOG00000007400 (Guinea pig)

Gene Details

WAP four-disulfide core domain 9

External Links

Gene Match (Ensembl Protein ID: ENSCPOP00000006674, Guinea pig)

Protein Percentage 70.59%
CDS Percentage 81.05%
Ka/Ks Ratio 0.33171 (Ka = 0.1749, Ks = 0.5274)

WFDC9 ENSG00000180205 (Human)

Gene Details

WAP four-disulfide core domain 9

External Links

Gene Match (Ensembl Protein ID: ENSP00000320532, Human)

Protein Percentage 60.53%
CDS Percentage 71.49%
Ka/Ks Ratio 0.41335 (Ka = 0.2896, Ks = 0.7006)

Wfdc9 ENSMUSG00000074594 (Mouse)

Gene Details

WAP four-disulfide core domain 9

External Links

Gene Match (Ensembl Protein ID: ENSMUSP00000104959, Mouse)

Protein Percentage 48.65%
CDS Percentage 63.06%
Ka/Ks Ratio 0.44483 (Ka = 0.4434, Ks = 0.9967)

Wfdc9 ENSRNOG00000031380 (Rat)

Gene Details

WAP four-disulfide core domain 9 (Wfdc9), mRNA

External Links

Gene Match (Ensembl Protein ID: ENSRNOP00000039834, Rat)

Protein Percentage 56.34%
CDS Percentage 66.67%
Ka/Ks Ratio 0.2794 (Ka = 0.3376, Ks = 1.2082)

Genome Location

Sequence Coding sequence

Length: 231 bp    Location: 8844701..8846005   Strand: +
>XM_004858245.1
ATGAAGTTCTGGATTTGCCTACTCATCATGGTTGTCTGTGGGGATTTGCCTGTGCTGGGAAGCCTCAGGACAAAATATGAGAGTGATGAAATAGCATCAGCTGATGAGTGCTGGGTACAACCTCCATCAGAGTATTGTGCAAAAAGATGCACGAGGCTACAGACGTGCTTGAATCCTAATCATACATGCTGTTGGACCTATTGTGGAAATATCTGCTGGGACAAGGCGTGA

Related Sequences

XP_004858302.1 Protein

Wfdc9 PREDICTED: protein WFDC9 [Heterocephalus glaber]

Length: 76 aa      View alignments
>XP_004858302.1
MKFWICLLIMVVCGDLPVLGSLRTKYESDEIASADECWVQPPSEYCAKRCTRLQTCLNPNHTCCWTYCGNICWDKA