Details from NCBI annotation

Gene Symbol Fxyd2
Gene Name FXYD domain containing ion transport regulator 2, transcript variant X4
Entrez Gene ID 101704851

Database interlinks

Part of NW_004624784.1 (Scaffold)

For more information consult the page for NW_004624784.1 (Scaffold)

Potential Gene Matches

The following genes have been identified as possible homologs of the naked mole-rat gene and compared to it.

FXYD2 ENSCPOG00000014050 (Guinea pig)

Gene Details

FXYD domain containing ion transport regulator 2

External Links

Gene Match (Ensembl Protein ID: ENSCPOP00000019935, Guinea pig)

Protein Percentage 100.0%
CDS Percentage 92.98%
Ka/Ks Ratio 0.001 (Ka = 0.0004, Ks = 0.3916)

FXYD2 ENSG00000137731 (Human)

Gene Details

FXYD domain containing ion transport regulator 2

External Links

Gene Match (Ensembl Protein ID: ENSP00000292079, Human)

Protein Percentage 75.0%
CDS Percentage 80.73%
Ka/Ks Ratio 0.20406 (Ka = 0.153, Ks = 0.7497)

Fxyd2 ENSMUSG00000059412 (Mouse)

Gene Details

FXYD domain-containing ion transport regulator 2

External Links

Gene Match (Ensembl Protein ID: ENSMUSP00000035429, Mouse)

Protein Percentage 79.69%
CDS Percentage 80.73%
Ka/Ks Ratio 0.12171 (Ka = 0.1247, Ks = 1.0243)

FXYD2 ENSRNOG00000016469 (Rat)

Gene Details

FXYD domain-containing ion transport regulator 2 (Fxyd2), transcript variant b, mRNA

External Links

Gene Match (Ensembl Protein ID: ENSRNOP00000022074, Rat)

Protein Percentage 76.56%
CDS Percentage 78.13%
Ka/Ks Ratio 0.17001 (Ka = 0.164, Ks = 0.9649)

Genome Location

Sequence Coding sequence

Length: 195 bp    Location: 13207061..13200018   Strand: -
>XM_004856679.1
ATGGACAGGTGGCACTTGGGTGGCAGCTCCAAGGGCGACGTGGACCCCTTCCACTATGACTACGAGACTGTCCGAAATGGAGGCCTGATCTTTGCTGGCCTAGCCTTCGTCGTGGGGCTCATCATCCTCCTCAGCAAACGGTTCCGCTGCGGGGGCAGTAGGAAGCCTCGGCAAGTCGGTGAAGATGAGCTGTAA

Related Sequences

XP_004856736.1 Protein

Fxyd2 PREDICTED: sodium/potassium-transporting ATPase subunit gamma isoform X4 [Heterocephalus glaber]

Length: 64 aa      View alignments
>XP_004856736.1
MDRWHLGGSSKGDVDPFHYDYETVRNGGLIFAGLAFVVGLIILLSKRFRCGGSRKPRQVGEDEL