Sequence details NCBI ID: XM_004856510.1 (Coding sequence)

Details from NCBI annotation

Gene Symbol LOC101708941
Gene Name spindle and kinetochore-associated protein 2-like
Entrez Gene ID 101708941

Database interlinks

Part of NW_004624784.1 (Scaffold)

For more information consult the page for NW_004624784.1 (Scaffold)

Genome Location

Sequence Coding sequence

Length: 189 bp    Location: 2779940..2780472   Strand: +
Raw sequence   
>XM_004856510.1
ATGGAGGCGGAGCTCAATAAGCTGGAACTCATATTCCAGAAAGCTGACTCTGATCTGGATTACATTCAGTACAGGCTGGAATATGAAACCAAGATTAATCATCCTGATTCAGCAGGCGAGCTGTCGTCACTGACTGAAGAAGAAAAAACTGTGACAGAGCAGTTGAAATCTCACATTCCACACTTATGA

Related Sequences

XP_004856567.1 Protein

LOC101708941 PREDICTED: spindle and kinetochore-associated protein 2-like [Heterocephalus glaber]

Length: 62 aa      
>XP_004856567.1
MEAELNKLELIFQKADSDLDYIQYRLEYETKINHPDSAGELSSLTEEEKTVTEQLKSHIPHL