Sequence details NCBI ID: XM_004856394.1 (Coding sequence)   Best Hit

Details from NCBI annotation

Gene Symbol Hilpda
Gene Name hypoxia inducible lipid droplet-associated
Entrez Gene ID 101720002

Database interlinks

Part of NW_004624783.1 (Scaffold)

For more information consult the page for NW_004624783.1 (Scaffold)

Potential Gene Matches

The following genes have been identified as possible homologs of the naked mole-rat gene and compared to it.

HILPDA ENSCPOG00000006271 (Guinea pig)

Gene Details

hypoxia inducible lipid droplet-associated

External Links

Gene Match (Ensembl Protein ID: ENSCPOP00000005654, Guinea pig)

Protein Percentage 82.81%
CDS Percentage 85.42%
Ka/Ks Ratio 0.36039 (Ka = 0.114, Ks = 0.3164)

HILPDA ENSG00000135245 (Human)

Gene Details

hypoxia inducible lipid droplet-associated

External Links

Gene Match (Ensembl Protein ID: ENSP00000257696, Human)

Protein Percentage 73.02%
CDS Percentage 78.31%
Ka/Ks Ratio 0.21674 (Ka = 0.1526, Ks = 0.7042)

Hilpda ENSMUSG00000043421 (Mouse)

Gene Details

hypoxia inducible lipid droplet associated

External Links

Gene Match (Ensembl Protein ID: ENSMUSP00000060791, Mouse)

Protein Percentage 75.0%
CDS Percentage 74.48%
Ka/Ks Ratio 0.10076 (Ka = 0.1556, Ks = 1.5446)

Genome Location

Sequence Coding sequence

Length: 195 bp    Location: 7538279..7536393   Strand: -
Raw sequence   
>XM_004856394.1
ATGAAGTATATTTTGAGTCTGTACCTGCTGGGTGTAGTGCTCACCCTGCTCTCTGTCTTCGTTAGGCTGATGGAGTCACTGGAGGGATTACTGGAGAGCCCATTGCCTGTGAGCCCCTGGGCCATCAGAGGTCATTTAGCCAACACCGAGCTCCCCAAAGGTCTTCCTGACCACCCGTCCAGAGGAGTGCAATAA

Related Sequences

XP_004856451.1 Protein

Hilpda PREDICTED: hypoxia-inducible lipid droplet-associated protein [Heterocephalus glaber]

Length: 64 aa      
>XP_004856451.1
MKYILSLYLLGVVLTLLSVFVRLMESLEGLLESPLPVSPWAIRGHLANTELPKGLPDHPSRGVQ