Details from NCBI annotation

Gene Symbol Smim3
Gene Name small integral membrane protein 3
Entrez Gene ID 101698125

Database interlinks

Part of NW_004624774.1 (Scaffold)

For more information consult the page for NW_004624774.1 (Scaffold)

Potential Gene Matches

The following genes have been identified as possible homologs of the naked mole-rat gene and compared to it.

SMIM3 ENSCPOG00000024226 (Guinea pig)

Gene Details

small integral membrane protein 3

External Links

Gene Match (Ensembl Protein ID: ENSCPOP00000017765, Guinea pig)

Protein Percentage 91.67%
CDS Percentage 92.78%
Ka/Ks Ratio 0.20093 (Ka = 0.0404, Ks = 0.2009)

SMIM3 ENSG00000256235 (Human)

Gene Details

small integral membrane protein 3

External Links

Gene Match (Ensembl Protein ID: ENSP00000436897, Human)

Protein Percentage 90.0%
CDS Percentage 88.33%
Ka/Ks Ratio 0.18963 (Ka = 0.0669, Ks = 0.353)

Smim3 ENSMUSG00000038059 (Mouse)

Gene Details

small integral membrane protein 3

External Links

Gene Match (Ensembl Protein ID: ENSMUSP00000039285, Mouse)

Protein Percentage 86.67%
CDS Percentage 86.11%
Ka/Ks Ratio 0.10447 (Ka = 0.065, Ks = 0.6225)

Smim3 ENSRNOG00000019536 (Rat)

Gene Details

small integral membrane protein 3 (Smim3), mRNA

External Links

Gene Match (Ensembl Protein ID: ENSRNOP00000026426, Rat)

Protein Percentage 85.0%
CDS Percentage 84.44%
Ka/Ks Ratio 0.09472 (Ka = 0.0741, Ks = 0.7824)

Genome Location

Sequence Coding sequence

Length: 183 bp    Location: 10026068..10048879   Strand: +
>XM_004854435.1
ATGGATGCTATCAGCCAATCCCCTGCAGAAGCTGTGCTTCCCAAGCACATCTTGGATATCTGGGTCATTGTCCTCATCATCCTGGCCACCATTGTCATCATGACGTCCTTGTTGCTATGCCCAGCCACTGCAGTCATCATCTATCGCATACGGACTCATCCGGTCCTGAGTGGTGCTGTCTGA

Related Sequences

XP_004854492.1 Protein

Smim3 PREDICTED: small integral membrane protein 3 [Heterocephalus glaber]

Length: 60 aa      View alignments
>XP_004854492.1
MDAISQSPAEAVLPKHILDIWVIVLIILATIVIMTSLLLCPATAVIIYRIRTHPVLSGAV