Details from NCBI annotation

Gene Symbol Riiad1
Gene Name regulatory subunit of type II PKA R-subunit (RIIa) domain containing 1
Entrez Gene ID 101698121

Database interlinks

Part of NW_004624772.1 (Scaffold)

For more information consult the page for NW_004624772.1 (Scaffold)

Potential Gene Matches

The following genes have been identified as possible homologs of the naked mole-rat gene and compared to it.

RIIAD1 ENSCPOG00000021943 (Guinea pig)

Gene Details

regulatory subunit of type II PKA R-subunit (RIIa) domain containing 1

External Links

Gene Match (Ensembl Protein ID: ENSCPOP00000021060, Guinea pig)

Protein Percentage 83.7%
CDS Percentage 87.32%
Ka/Ks Ratio 0.24522 (Ka = 0.0833, Ks = 0.3395)

RIIAD1 ENSG00000178796 (Human)

Gene Details

regulatory subunit of type II PKA R-subunit (RIIa) domain containing 1

External Links

Gene Match (Ensembl Protein ID: ENSP00000419249, Human)

Protein Percentage 77.17%
CDS Percentage 82.25%
Ka/Ks Ratio 0.22479 (Ka = 0.1235, Ks = 0.5494)

Riiad1 ENSMUSG00000028139 (Mouse)

Gene Details

regulatory subunit of type II PKA R-subunit (RIIa) domain containing 1

External Links

Gene Match (Ensembl Protein ID: ENSMUSP00000029785, Mouse)

Protein Percentage 77.17%
CDS Percentage 77.54%
Ka/Ks Ratio 0.16264 (Ka = 0.149, Ks = 0.9159)

Riiad1 ENSRNOG00000037310 (Rat)

Gene Details

regulatory subunit of type II PKA R-subunit (RIIa) domain containing 1 (Riiad1), mRNA

External Links

Gene Match (Ensembl Protein ID: ENSRNOP00000053287, Rat)

Protein Percentage 75.0%
CDS Percentage 75.72%
Ka/Ks Ratio 0.15319 (Ka = 0.1637, Ks = 1.0687)

Genome Location

Sequence Coding sequence

Length: 279 bp    Location: 19407344..19412186   Strand: +
>XM_004854094.1
ATGGCGACGCCACAGGATCCGCCTCCGGGACGCGACCCCGGGCTCCTGAGCCCCGCGCAGCTGGAGAGGCTGCGGAACTTCAAGATCCAGACGCGCATTGCTAATGAAAAGTACCTAAGGACCCGCAAGGAAGTGAAGTTGCTCCTCAGCGGCTTCTTCAGAGAGATGTTCCTGAAAAGGCCGGACAACGTGCTAGAATTTGCTGCAGACTATTTCACGGATCCAAGACTTCCCAACAAGATTCACATGCAGCTAATTAAAGACAAGAAAGTGACTTAA

Related Sequences

XP_004854151.1 Protein

Riiad1 PREDICTED: RIIa domain-containing protein 1 [Heterocephalus glaber]

Length: 92 aa      View alignments
>XP_004854151.1
MATPQDPPPGRDPGLLSPAQLERLRNFKIQTRIANEKYLRTRKEVKLLLSGFFREMFLKRPDNVLEFAADYFTDPRLPNKIHMQLIKDKKVT