Details from NCBI annotation

Gene Symbol Camk2n1
Gene Name calcium/calmodulin-dependent protein kinase II inhibitor 1
Entrez Gene ID 101712739

Database interlinks

Part of NW_004624764.1 (Scaffold)

For more information consult the page for NW_004624764.1 (Scaffold)

Potential Gene Matches

The following genes have been identified as possible homologs of the naked mole-rat gene and compared to it.

CAMK2N1 ENSCPOG00000024062 (Guinea pig)

Gene Details

calcium/calmodulin-dependent protein kinase II inhibitor 1

External Links

Gene Match (Ensembl Protein ID: ENSCPOP00000017971, Guinea pig)

Protein Percentage 100.0%
CDS Percentage 97.44%
Ka/Ks Ratio 0.001 (Ka = 0.0002, Ks = 0.153)

CAMK2N1 ENSG00000162545 (Human)

Gene Details

calcium/calmodulin-dependent protein kinase II inhibitor 1

External Links

Gene Match (Ensembl Protein ID: ENSP00000364219, Human)

Protein Percentage 100.0%
CDS Percentage 98.72%
Ka/Ks Ratio 0.001 (Ka = 0.0001, Ks = 0.0761)

Camk2n1 ENSMUSG00000046447 (Mouse)

Gene Details

calcium/calmodulin-dependent protein kinase II inhibitor 1

External Links

Gene Match (Ensembl Protein ID: ENSMUSP00000060349, Mouse)

Protein Percentage 97.44%
CDS Percentage 95.73%
Ka/Ks Ratio 0.04105 (Ka = 0.0103, Ks = 0.2516)

Camk2n1 ENSRNOG00000016322 (Rat)

Gene Details

calcium/calmodulin-dependent protein kinase II inhibitor 1 (Camk2n1), mRNA

External Links

Gene Match (Ensembl Protein ID: ENSRNOP00000021864, Rat)

Protein Percentage 97.44%
CDS Percentage 97.01%
Ka/Ks Ratio 0.06897 (Ka = 0.0103, Ks = 0.1491)

Genome Location

Sequence Coding sequence

Length: 237 bp    Location: 5547569..5545784   Strand: -
>XM_004850460.1
ATGTCGGAGGTGCTGCCCTACGGCGACGAGAAGCTGAGCCCCTACGGCGACGGCGGCGACGTGGGCCAGATCTTCTCCTGCCGCCTGCAGGACACCAACAACTTCTTCGGCGCCGGGCAGAACAAGCGGCCGCCCAAGCTGGGGCAGATTGGCCGGAGCAAGCGGGTTGTTATTGAAGATGATAGGATTGATGACGTGCTGAAAAACATGACCGACAAGGCACCTCCTGGTGTCTAA

Related Sequences

XP_004850517.1 Protein

Camk2n1 PREDICTED: calcium/calmodulin-dependent protein kinase II inhibitor 1 [Heterocephalus glaber]

Length: 78 aa      View alignments
>XP_004850517.1
MSEVLPYGDEKLSPYGDGGDVGQIFSCRLQDTNNFFGAGQNKRPPKLGQIGRSKRVVIEDDRIDDVLKNMTDKAPPGV