Sequence details NCBI ID: XM_004850149.1 (Coding sequence)

Details from NCBI annotation

Gene Symbol Rpl30
Gene Name ribosomal protein L30
Entrez Gene ID 101711668

Database interlinks

Part of NW_004624763.1 (Scaffold)

For more information consult the page for NW_004624763.1 (Scaffold)

Genome Location

Sequence Coding sequence

Length: 171 bp    Location: 5192502..5191999   Strand: -
Raw sequence   
>XM_004850149.1
ATGGTGGCCGCAAAGAAGACGAAAAAATCTCTGGAGTCCATCAACTCTAGACTCCAACTTGTTATGAAAAGTGGAAAATACGTGCTGGGTTACAAGCAGACACTGAAGATGATCAGACAGGGGAAAGGGAAATTGGTCATCCTCGCCAACAACTGCCCGGCTTTGAGGTAA

Related Sequences

XP_004850206.1 Protein

Rpl30 PREDICTED: 60S ribosomal protein L30 [Heterocephalus glaber]

Length: 56 aa      
>XP_004850206.1
MVAAKKTKKSLESINSRLQLVMKSGKYVLGYKQTLKMIRQGKGKLVILANNCPALR