Details from NCBI annotation

Gene Symbol Txndc8
Gene Name thioredoxin domain containing 8 (spermatozoa)
Entrez Gene ID 101712725

Database interlinks

Part of NW_004624758.1 (Scaffold)

For more information consult the page for NW_004624758.1 (Scaffold)

Potential Gene Matches

The following genes have been identified as possible homologs of the naked mole-rat gene and compared to it.

TXNDC8 ENSCPOG00000011769 (Guinea pig)

Gene Details

thioredoxin domain containing 8 (spermatozoa)

External Links

Gene Match (Ensembl Protein ID: ENSCPOP00000010585, Guinea pig)

Protein Percentage 57.94%
CDS Percentage 70.72%
Ka/Ks Ratio 0.64508 (Ka = 0.3527, Ks = 0.5467)

TXNDC8 ENSG00000204193 (Human)

Gene Details

thioredoxin domain containing 8 (spermatozoa)

External Links

Gene Match (Ensembl Protein ID: ENSP00000363634, Human)

Protein Percentage 62.62%
CDS Percentage 73.83%
Ka/Ks Ratio 0.4469 (Ka = 0.276, Ks = 0.6177)

Txndc8 ENSMUSG00000038709 (Mouse)

Gene Details

thioredoxin domain containing 8

External Links

Gene Match (Ensembl Protein ID: ENSMUSP00000099961, Mouse)

Protein Percentage 57.94%
CDS Percentage 67.6%
Ka/Ks Ratio 0.44055 (Ka = 0.3661, Ks = 0.8311)

Txndc8 ENSRNOG00000029073 (Rat)

Gene Details

thioredoxin domain containing 8 (Txndc8), mRNA

External Links

Gene Match (Ensembl Protein ID: ENSRNOP00000041009, Rat)

Protein Percentage 57.01%
CDS Percentage 68.85%
Ka/Ks Ratio 0.54981 (Ka = 0.3712, Ks = 0.6752)

Genome Location

Sequence Coding sequence

Length: 324 bp    Location: 1219356..1235070   Strand: +
>XM_004848465.1
ATGGTGCAGATTATTAAAGACACGAATGAGTTGACAGCATTTTTGAAAGCTGCTGGGCACAAACTTGTAGTGGTGGAATTTTCAGCAAAATGGTGTGGTCCCTGCAAATTGATGGCTCCTATTTTTCACGCAATGTCTTTGAAATACAAAAATGTAGTGTTTGCTAAAGTGGACGTGGATGAATCACAGGAGTTGGCTGAATTTTGTAACATCAAAGCAATACCCACATTTAAGATGTTCAAGCAAACCCAAAAGAATTACCTCATCCCTGGGAACTTATGCTATAGAAATACCTCAAAGAAAAATGCACAGTTAAGTCTATAG

Related Sequences

XP_004848522.1 Protein

Txndc8 PREDICTED: thioredoxin domain-containing protein 8 [Heterocephalus glaber]

Length: 107 aa      View alignments
>XP_004848522.1
MVQIIKDTNELTAFLKAAGHKLVVVEFSAKWCGPCKLMAPIFHAMSLKYKNVVFAKVDVDESQELAEFCNIKAIPTFKMFKQTQKNYLIPGNLCYRNTSKKNAQLSL