Details from NCBI annotation

Gene Symbol Cxcl10
Gene Name chemokine (C-X-C motif) ligand 10
Entrez Gene ID 101717531

Database interlinks

Part of NW_004624757.1 (Scaffold)

For more information consult the page for NW_004624757.1 (Scaffold)

Potential Gene Matches

The following genes have been identified as possible homologs of the naked mole-rat gene and compared to it.

CXCL10 ENSCPOG00000002046 (Guinea pig)

Gene Details

chemokine (C-X-C motif) ligand 10

External Links

Gene Match (Ensembl Protein ID: ENSCPOP00000001852, Guinea pig)

Protein Percentage 88.54%
CDS Percentage 92.01%
Ka/Ks Ratio 0.3339 (Ka = 0.0576, Ks = 0.1727)

CXCL10 ENSG00000169245 (Human)

Gene Details

chemokine (C-X-C motif) ligand 10

External Links

Gene Match (Ensembl Protein ID: ENSP00000305651, Human)

Protein Percentage 84.38%
CDS Percentage 87.15%
Ka/Ks Ratio 0.25926 (Ka = 0.0919, Ks = 0.3545)

Cxcl10 ENSMUSG00000034855 (Mouse)

Gene Details

chemokine (C-X-C motif) ligand 10

External Links

Gene Match (Ensembl Protein ID: ENSMUSP00000047646, Mouse)

Protein Percentage 66.67%
CDS Percentage 72.92%
Ka/Ks Ratio 0.38939 (Ka = 0.2798, Ks = 0.7185)

Cxcl10 ENSRNOG00000022256 (Rat)

Gene Details

chemokine (C-X-C motif) ligand 10 (Cxcl10), mRNA

External Links

Gene Match (Ensembl Protein ID: ENSRNOP00000003649, Rat)

Protein Percentage 66.67%
CDS Percentage 74.65%
Ka/Ks Ratio 0.42345 (Ka = 0.2576, Ks = 0.6082)

Genome Location

Sequence Coding sequence

Length: 291 bp    Location: 14989254..14991415   Strand: +
>XM_004848040.1
ATGAGCCACACCATTCTTATTTTCTGCCTCATCTTTCTGACCTTGAGTGGGATTCAAGGAATACCTCTTTCCAGAACTATACGCTGTACCTGCATTGAGACTAGTACTCAATCTGTTAATCCAAGGTTCTTAAAGAAACTTGAAATTATCCCTGCAAGTCAATCTTGTCCACGTGTTGAGATCATTGCCACAATGAAAAAGAACAGGGAGAAGAGATGTCTGAATCCAGAATCTAAGGCCATCAAGAATTTATTGAAAGCAGTTAGAAAAGAAAGGTCTAAAAGATCTTAA

Related Sequences

XP_004848097.1 Protein

Cxcl10 PREDICTED: c-X-C motif chemokine 10 [Heterocephalus glaber]

Length: 96 aa      View alignments
>XP_004848097.1
MSHTILIFCLIFLTLSGIQGIPLSRTIRCTCIETSTQSVNPRFLKKLEIIPASQSCPRVEIIATMKKNREKRCLNPESKAIKNLLKAVRKERSKRS