Details from NCBI annotation

Gene Symbol Smim20
Gene Name small integral membrane protein 20
Entrez Gene ID 101697723

Database interlinks

Part of NW_004624755.1 (Scaffold)

For more information consult the page for NW_004624755.1 (Scaffold)

Potential Gene Matches

The following genes have been identified as possible homologs of the naked mole-rat gene and compared to it.

SMIM20 ENSCPOG00000007684 (Guinea pig)

Gene Details

small integral membrane protein 20

External Links

Gene Match (Ensembl Protein ID: ENSCPOP00000006924, Guinea pig)

Protein Percentage 98.51%
CDS Percentage 95.02%
Ka/Ks Ratio 0.0293 (Ka = 0.0066, Ks = 0.2236)

SMIM20 ENSG00000250317 (Human)

Gene Details

small integral membrane protein 20

External Links

Gene Match (Ensembl Protein ID: ENSP00000427407, Human)

Protein Percentage 95.52%
CDS Percentage 93.53%
Ka/Ks Ratio 0.09161 (Ka = 0.0207, Ks = 0.2255)

Smim20 ENSMUSG00000061461 (Mouse)

Gene Details

small integral membrane protein 20

External Links

Gene Match (Ensembl Protein ID: ENSMUSP00000113019, Mouse)

Protein Percentage 92.54%
CDS Percentage 89.55%
Ka/Ks Ratio 0.10023 (Ka = 0.041, Ks = 0.4093)

Smim20 ENSRNOG00000046603 (Rat)

Gene Details

small integral membrane protein 20

External Links

Gene Match (Ensembl Protein ID: ENSRNOP00000065095, Rat)

Protein Percentage 76.12%
CDS Percentage 75.62%
Ka/Ks Ratio 0.15375 (Ka = 0.1719, Ks = 1.1182)

Genome Location

Sequence Coding sequence

Length: 204 bp    Location: 6635901..6625911   Strand: -
>XM_004847189.1
ATGTCCCGGAACCTGCGCACCGCGCTCATTTTCGGCGGCTTCTTCTCCTTGGTCGGCGCCGCCTTCTACCCCATCTACTTCCGGCCCCTAATGAGGCTGGAGGAGTACCAGAAGGAACAAGCGATCAATCGGGCTGGGATTGTCCAAGAAGATGTGCAACCACCAGGGTTAAAAGTGTGGTCTGATCCATTTGGCAGGAAATGA

Related Sequences

XP_004847246.1 Protein

Smim20 PREDICTED: small integral membrane protein 20 [Heterocephalus glaber]

Length: 67 aa      View alignments
>XP_004847246.1
MSRNLRTALIFGGFFSLVGAAFYPIYFRPLMRLEEYQKEQAINRAGIVQEDVQPPGLKVWSDPFGRK