| Gene Symbol | Pcbd1 |
|---|---|
| Gene Name | pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha |
| Entrez Gene ID | 101719124 |
For more information consult the page for NW_004624754.1 (Scaffold)
The following genes have been identified as possible homologs of the naked mole-rat gene and compared to it.
pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha
| Protein Percentage | 100.0% |
|---|---|
| CDS Percentage | 94.82% |
| Ka/Ks Ratio | 0.001 (Ka = 0.0002, Ks = 0.2317) |
pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha
| Protein Percentage | 100.0% |
|---|---|
| CDS Percentage | 92.63% |
| Ka/Ks Ratio | 0.001 (Ka = 0.0004, Ks = 0.3974) |
pterin 4 alpha carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 1
| Protein Percentage | 99.04% |
|---|---|
| CDS Percentage | 89.74% |
| Ka/Ks Ratio | 0.0078 (Ka = 0.0044, Ks = 0.5628) |
pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (Pcbd1), mRNA
| Protein Percentage | 100.0% |
|---|---|
| CDS Percentage | 90.06% |
| Ka/Ks Ratio | 0.001 (Ka = 0.0006, Ks = 0.5779) |
>XM_004846217.1 ATGGCTGGCAAAGCACACAGGCTGAGTGCTGAAGAGAGGGATCAGCTGTTGCCCAACCTGAGGGCTGTGGGGTGGAATGAGCTAGAAGGCCGAGATGCCATCTTCAAGCAGTTCCACTTCAAAGATTTCAACAGGGCTTTTGGCTTCATGACCAGAGTGGCTCTGCAGGCTGAAAAGCTGGACCACCATCCTGAATGGTTTAATGTATACAACAAGGTGCACATCACCCTGAGCACCCATGAATGTGCGGGCCTTTCAGAACGGGATATAAACCTGGCCAGCTTCATCGAACAAGTAGCAGTGTCCATGACATAG
Pcbd1 PREDICTED: pterin-4-alpha-carbinolamine dehydratase [Heterocephalus glaber]
Length: 104 aa View alignments>XP_004846274.1 MAGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT