Details from NCBI annotation

Gene Symbol unclassified transcription discrepancy
Gene Name mRNA
Entrez Gene ID 101717519

Database interlinks

Part of NW_004624752.1 (Scaffold)

For more information consult the page for NW_004624752.1 (Scaffold)

Potential Gene Matches

The following genes have been identified as possible homologs of the naked mole-rat gene and compared to it.

PDE6H ENSCPOG00000025430 (Guinea pig)

Gene Details

phosphodiesterase 6H, cGMP-specific, cone, gamma

External Links

Gene Match (Ensembl Protein ID: ENSCPOP00000016183, Guinea pig)

Protein Percentage 93.98%
CDS Percentage 89.16%
Ka/Ks Ratio 0.06704 (Ka = 0.0245, Ks = 0.3657)

PDE6H ENSG00000139053 (Human)

Gene Details

phosphodiesterase 6H, cGMP-specific, cone, gamma

External Links

Gene Match (Ensembl Protein ID: ENSP00000266395, Human)

Protein Percentage 90.36%
CDS Percentage 85.94%
Ka/Ks Ratio 0.0828 (Ka = 0.0428, Ks = 0.5174)

Pde6h ENSMUSG00000064330 (Mouse)

Gene Details

phosphodiesterase 6H, cGMP-specific, cone, gamma

External Links

Gene Match (Ensembl Protein ID: ENSMUSP00000119246, Mouse)

Protein Percentage 90.36%
CDS Percentage 87.15%
Ka/Ks Ratio 0.1049 (Ka = 0.046, Ks = 0.4388)

Pde6h ENSRNOG00000005947 (Rat)

Gene Details

phosphodiesterase 6H, cGMP-specific, cone, gamma (Pde6h), mRNA

External Links

Gene Match (Ensembl Protein ID: ENSRNOP00000007905, Rat)

Protein Percentage 90.36%
CDS Percentage 86.35%
Ka/Ks Ratio 0.10829 (Ka = 0.0516, Ks = 0.4765)

Genome Location

Sequence Coding sequence

Length: 252 bp    Location: 23055103..23051752   Strand: -
>XM_004845826.1
ATGAATGACAATGCTACTTTGGCTACTCCAGCACCAAGCCAGGGTCCCACTACCCCCCACAAAGGACCCCCCAAGTTCAAGCAGAGGNNCACTCGCCAATTCAAGAGCAAGCCTCCGAAGAAAGGTGTGAAAGGGTTTGGAGATGACATCCCAGGCATGGAGGGGCTGGGAACAGATATCACGGTGATCTGCCCTTGGGAGGCTTTCAGCCATCTGGAGCTGCATGAACTCGCTCAGTTTGGGATCATCTAA

Related Sequences

XP_004845883.1 Protein

unclassified transcription discrepancy PREDICTED: LOW QUALITY PROTEIN: retinal cone rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit gamma [Heterocephalus glaber]

Length: 83 aa      View alignments
>XP_004845883.1
MNDNATLATPAPSQGPTTPHKGPPKFKQRXTRQFKSKPPKKGVKGFGDDIPGMEGLGTDITVICPWEAFSHLELHELAQFGII