| Gene Symbol | Triap1 |
|---|---|
| Gene Name | TP53 regulated inhibitor of apoptosis 1 |
| Entrez Gene ID | 101698065 |
For more information consult the page for NW_004624747.1 (Scaffold)
The following genes have been identified as possible homologs of the naked mole-rat gene and compared to it.
| Protein Percentage | 98.68% |
|---|---|
| CDS Percentage | 94.74% |
| Ka/Ks Ratio | 0.02032 (Ka = 0.0056, Ks = 0.2774) |
TP53 regulated inhibitor of apoptosis 1
| Protein Percentage | 98.68% |
|---|---|
| CDS Percentage | 94.3% |
| Ka/Ks Ratio | 0.0175 (Ka = 0.0056, Ks = 0.3183) |
TP53 regulated inhibitor of apoptosis 1
| Protein Percentage | 100.0% |
|---|---|
| CDS Percentage | 93.42% |
| Ka/Ks Ratio | 0.001 (Ka = 0.0004, Ks = 0.4459) |
>XM_004843667.1 ATGACATCAGAGCGCGCCTCTGTGGCTACAGCTTTCGCCATGAACAGCGTCGGAGAGGCTTGCACTGATATGAAGCGCGAGTACGACCAGTGCTTCAATCGCTGGTTTGCCGAGAAGTTTCTCAAGGGGGACGGTTCCGGGGATCCGTGCACCGATCTCTTCAAGCGCTACCAGCAGTGTGTTCAGAAAGCAATAAAGGAGAAAGAGATTCCTATTGAAGGACTGGAGTTCATGGGCCATGGCAAAGAAAAGCCTGAAAACTCTTCTTGA
Triap1 PREDICTED: TP53-regulated inhibitor of apoptosis 1 [Heterocephalus glaber]
Length: 89 aa>XP_004843724.1 MTSERASVATAFAMNSVGEACTDMKREYDQCFNRWFAEKFLKGDGSGDPCTDLFKRYQQCVQKAIKEKEIPIEGLEFMGHGKEKPENSS