Details from NCBI annotation

Gene Symbol Smim11
Gene Name small integral membrane protein 11, transcript variant X5
Entrez Gene ID 101702616

Database interlinks

Part of NW_004624745.1 (Scaffold)

For more information consult the page for NW_004624745.1 (Scaffold)

Potential Gene Matches

The following genes have been identified as possible homologs of the naked mole-rat gene and compared to it.

SMIM11 ENSCPOG00000005591 (Guinea pig)

Gene Details

small integral membrane protein 11

External Links

Gene Match (Ensembl Protein ID: ENSCPOP00000005037, Guinea pig)

Protein Percentage 90.0%
CDS Percentage 93.33%
Ka/Ks Ratio 0.38218 (Ka = 0.0498, Ks = 0.1302)

SMIM11 ENSG00000205670 (Human)

Gene Details

small integral membrane protein 11

External Links

Gene Match (Ensembl Protein ID: ENSP00000382234, Human)

Protein Percentage 91.23%
CDS Percentage 87.72%
Ka/Ks Ratio 0.12242 (Ka = 0.0505, Ks = 0.4123)

Smim11 ENSMUSG00000051989 (Mouse)

Gene Details

small integral membrane protein 11

External Links

Gene Match (Ensembl Protein ID: ENSMUSP00000113086, Mouse)

Protein Percentage 87.04%
CDS Percentage 85.8%
Ka/Ks Ratio 0.07203 (Ka = 0.0616, Ks = 0.8551)

Smim11 ENSRNOG00000039877 (Rat)

Gene Details

small integral membrane protein 11 (Smim11), mRNA

External Links

Gene Match (Ensembl Protein ID: ENSRNOP00000057946, Rat)

Protein Percentage 87.04%
CDS Percentage 87.65%
Ka/Ks Ratio 0.13297 (Ka = 0.0626, Ks = 0.4706)

Genome Location

Sequence Coding sequence

Length: 174 bp    Location: 22558420..22571811   Strand: +
>XM_004842337.1
ATGAACTGGAAGGTTCTCGATCACGTGCCCCTGCTGCTGTATATCTTGGCAGCAAAGACGCTGATTCTCTGCCTGGCATTTGCTGGAGTGAAAATGTACCAAAGGAAGACACTGGAAGGAAAACAGCAAAAACTGGAGGTTGAAAAGAAGCAGTCAGAGAAGAAAGATAACTGA

Related Sequences

XP_004842394.1 Protein

Smim11 PREDICTED: small integral membrane protein 11 isoform X5 [Heterocephalus glaber]

Length: 57 aa      View alignments
>XP_004842394.1
MNWKVLDHVPLLLYILAAKTLILCLAFAGVKMYQRKTLEGKQQKLEVEKKQSEKKDN