Details from NCBI annotation

Gene Symbol Pkia
Gene Name protein kinase (cAMP-dependent, catalytic) inhibitor alpha, transcript variant X5
Entrez Gene ID 101714948

Database interlinks

Part of NW_004624744.1 (Scaffold)

For more information consult the page for NW_004624744.1 (Scaffold)

Potential Gene Matches

The following genes have been identified as possible homologs of the naked mole-rat gene and compared to it.

PKIA ENSCPOG00000010918 (Guinea pig)

Gene Details

protein kinase (cAMP-dependent, catalytic) inhibitor alpha

External Links

Gene Match (Ensembl Protein ID: ENSCPOP00000009810, Guinea pig)

Protein Percentage 100.0%
CDS Percentage 96.49%
Ka/Ks Ratio 0.001 (Ka = 0.0002, Ks = 0.2117)

PKIA ENSG00000171033 (Human)

Gene Details

protein kinase (cAMP-dependent, catalytic) inhibitor alpha

External Links

Gene Match (Ensembl Protein ID: ENSP00000379696, Human)

Protein Percentage 97.37%
CDS Percentage 95.61%
Ka/Ks Ratio 0.05181 (Ka = 0.0111, Ks = 0.2147)

Pkia ENSMUSG00000027499 (Mouse)

Gene Details

protein kinase inhibitor, alpha

External Links

Gene Match (Ensembl Protein ID: ENSMUSP00000028999, Mouse)

Protein Percentage 97.37%
CDS Percentage 92.11%
Ka/Ks Ratio 0.02515 (Ka = 0.0117, Ks = 0.4659)

Pkia ENSRNOG00000012095 (Rat)

Gene Details

protein kinase (cAMP-dependent, catalytic) inhibitor alpha (Pkia), mRNA

External Links

Gene Match (Ensembl Protein ID: ENSRNOP00000016567, Rat)

Protein Percentage 97.37%
CDS Percentage 92.98%
Ka/Ks Ratio 0.02971 (Ka = 0.0116, Ks = 0.3906)

Genome Location

Sequence Coding sequence

Length: 231 bp    Location: 12742537..12707344   Strand: -
>XM_004842029.1
ATGACTGATGTGGAAACTACATATGCAGATTTTATTGCTTCAGGAAGAACAGGTAGAAGAAATGCAATACATGATATCCTGGTTTCCTCTGCAAGTGGTAACAGCAATGAATTAGCCCTGAAATTAGCTGGTCTTGATATCAACAAGACAGAAGGCGAAGATGATGCACAGAGGAATTCGACAGAACAAAGTGGGGAAGCCCAGGGAGAAGCAGCAAAATCTGAAAGCTAA

Related Sequences

XP_004842086.1 Protein

Pkia PREDICTED: cAMP-dependent protein kinase inhibitor alpha isoform X5 [Heterocephalus glaber]

Length: 76 aa      View alignments
>XP_004842086.1
MTDVETTYADFIASGRTGRRNAIHDILVSSASGNSNELALKLAGLDINKTEGEDDAQRNSTEQSGEAQGEAAKSES