Details from NCBI annotation

Gene Symbol Nrep
Gene Name neuronal regeneration related protein, transcript variant X3
Entrez Gene ID 101702272

Database interlinks

Part of NW_004624743.1 (Scaffold)

For more information consult the page for NW_004624743.1 (Scaffold)

Potential Gene Matches

The following genes have been identified as possible homologs of the naked mole-rat gene and compared to it.

NREP ENSCPOG00000002748 (Guinea pig)

Gene Details

neuronal regeneration related protein

External Links

Gene Match (Ensembl Protein ID: ENSCPOP00000002495, Guinea pig)

Protein Percentage 86.57%
CDS Percentage 90.05%
Ka/Ks Ratio 0.45465 (Ka = 0.0853, Ks = 0.1875)

NREP ENSG00000134986 (Human)

Gene Details

neuronal regeneration related protein

External Links

Gene Match (Ensembl Protein ID: ENSP00000378996, Human)

Protein Percentage 80.6%
CDS Percentage 89.55%
Ka/Ks Ratio 0.98927 (Ka = 0.1143, Ks = 0.1155)

Nrep ENSMUSG00000042834 (Mouse)

Gene Details

neuronal regeneration related protein

External Links

Gene Match (Ensembl Protein ID: ENSMUSP00000058132, Mouse)

Protein Percentage 74.63%
CDS Percentage 82.59%
Ka/Ks Ratio 0.56479 (Ka = 0.1717, Ks = 0.304)

Nrep ENSRNOG00000020467 (Rat)

Gene Details

neuronal regeneration related protein (Nrep), mRNA

External Links

Gene Match (Ensembl Protein ID: ENSRNOP00000027739, Rat)

Protein Percentage 71.64%
CDS Percentage 83.08%
Ka/Ks Ratio 0.74011 (Ka = 0.1812, Ks = 0.2448)

Genome Location

Sequence Coding sequence

Length: 204 bp    Location: 29557414..29529356   Strand: -
>XM_004841778.1
ATGGTTTACTACCCAGAACTCTGTGTCTGGGTCAGTCAAGAACCATTTCCAGACAAGGAAATGGAGGGAAGGCTTCCTAAGGGAAGCCTTCCCGTCCCAAAGGAGGTGAACCGCAAGAAGGAGGAGACCGATGCTGCCTGCCTGACTCCACTGGGCAGCGATAAACTCCGCTCCCCAAGTATCACTTACCTCCACTCTTTTTAA

Related Sequences

XP_004841835.1 Protein

Nrep PREDICTED: neuronal regeneration-related protein isoform X3 [Heterocephalus glaber]

Length: 67 aa      View alignments
>XP_004841835.1
MVYYPELCVWVSQEPFPDKEMEGRLPKGSLPVPKEVNRKKEETDAACLTPLGSDKLRSPSITYLHSF