Details from NCBI annotation

Gene Symbol Mrpl33
Gene Name mitochondrial ribosomal protein L33, transcript variant X2
Entrez Gene ID 101724495

Database interlinks

Part of NW_004624738.1 (Scaffold)

For more information consult the page for NW_004624738.1 (Scaffold)

Potential Gene Matches

The following genes have been identified as possible homologs of the naked mole-rat gene and compared to it.

MRPL33 ENSCPOG00000026794 (Guinea pig)

Gene Details

mitochondrial ribosomal protein L33

External Links

Gene Match (Ensembl Protein ID: ENSCPOP00000017258, Guinea pig)

Protein Percentage 89.09%
CDS Percentage 87.27%
Ka/Ks Ratio 0.21258 (Ka = 0.0745, Ks = 0.3503)

MRPL33 ENSG00000243147 (Human)

Gene Details

mitochondrial ribosomal protein L33

External Links

Gene Match (Ensembl Protein ID: ENSP00000296102, Human)

Protein Percentage 81.54%
CDS Percentage 85.64%
Ka/Ks Ratio 0.34086 (Ka = 0.1109, Ks = 0.3253)

Mrpl33 ENSMUSG00000029142 (Mouse)

Gene Details

mitochondrial ribosomal protein L33

External Links

Gene Match (Ensembl Protein ID: ENSMUSP00000031024, Mouse)

Protein Percentage 81.54%
CDS Percentage 82.56%
Ka/Ks Ratio 0.20283 (Ka = 0.1082, Ks = 0.5336)

Mrpl33 ENSRNOG00000025388 (Rat)

Gene Details

Brain and reproductive organ-expressed protein, isoform CRA_c; Protein Mrpl33

External Links

Gene Match (Ensembl Protein ID: ENSRNOP00000033059, Rat)

Protein Percentage 83.08%
CDS Percentage 84.62%
Ka/Ks Ratio 0.22436 (Ka = 0.0973, Ks = 0.4335)

Genome Location

Sequence Coding sequence

Length: 198 bp    Location: 9790505..9803802   Strand: +
>XM_004839226.1
ATGTTCCTTTCCGCTGTCTCCTTTGCCAAGAGCAAGTCAAAAACCCTTCTGGTGAGAATGGTGAGCCAGGCCGGGACAGGTATTACCTTCAATGCCAGGAGAGGCCGACTCCGGGAGAAATTGACCCTTTTGCATTATGATCCAGTTGTGAAAAAAAAAGTCCTCTTTGTGGAGCAGAAAAAAATACGCTCTCTCTAA

Related Sequences

XP_004839283.1 Protein

Mrpl33 PREDICTED: 39S ribosomal protein L33, mitochondrial isoform X2 [Heterocephalus glaber]

Length: 65 aa      View alignments
>XP_004839283.1
MFLSAVSFAKSKSKTLLVRMVSQAGTGITFNARRGRLREKLTLLHYDPVVKKKVLFVEQKKIRSL