Sequence details NCBI ID: XM_004838113.1 (Coding sequence)

Details from NCBI annotation

Gene Symbol LOC101724716
Gene Name enhancer of polycomb homolog 2-like
Entrez Gene ID 101724716

Database interlinks

Part of NW_004624735.1 (Scaffold)

For more information consult the page for NW_004624735.1 (Scaffold)

Genome Location

Sequence Coding sequence

Length: 147 bp    Location: 30157304..30157131   Strand: -
Raw sequence   
>XM_004838113.1
AACTTGCCACAGTTGCTGCCAGTATGGACAGTGCCACAGGTTACTCCCAGTAGTGCCATCAGCAGCATAGCAAGAAAGAACCATGAACCAGAAAGATTGGGTTTAAATGGAATAGCAGAGACAACAGTAGCTATGGAAGTGACATAA

Related Sequences

XP_004838170.1 Protein

LOC101724716 PREDICTED: enhancer of polycomb homolog 2-like, partial [Heterocephalus glaber]

Length: 48 aa      
>XP_004838170.1
NLPQLLPVWTVPQVTPSSAISSIARKNHEPERLGLNGIAETTVAMEVT