Details from NCBI annotation

Gene Symbol LOC101698905
Gene Name cytochrome c oxidase assembly protein COX16 homolog, mitochondrial-like, transcript variant X6
Entrez Gene ID 101698905

Database interlinks

Part of NW_004624734.1 (Scaffold)

For more information consult the page for NW_004624734.1 (Scaffold)

Genome Location

Sequence Coding sequence

Length: 249 bp    Location: 30776837..30790232   Strand: +
>XM_004837302.1
ATGTTCACACCCGCGGTGATGCGAGCTTTGAGCAAGAACAAGACCCTTCGCTACGGAGTCCCCATGTTGATTGATCCTGAATTGGAAAAAAAGCTGAAAATGAATAAAATATCTTTAGAGTCAGAATATGAGAAAATAAAGGACTCTACTTTTGAAGACTGGAAGAATATTCGTGGCCCAAGGCCTTGGGAAGATCCTGATCTCCTTCAAGGACGAAATCCAGAAATCCTTAAGACTAAGACTACGTGA

Related Sequences

XP_004837359.1 Protein

LOC101698905 PREDICTED: cytochrome c oxidase assembly protein COX16 homolog, mitochondrial-like isoform X6 [Heterocephalus glaber]

Length: 82 aa     
>XP_004837359.1
MFTPAVMRALSKNKTLRYGVPMLIDPELEKKLKMNKISLESEYEKIKDSTFEDWKNIRGPRPWEDPDLLQGRNPEILKTKTT