Details from NCBI annotation

Gene Symbol Atox1
Gene Name antioxidant 1 copper chaperone
Entrez Gene ID 101697402

Database interlinks

Part of NW_004624733.1 (Scaffold)

For more information consult the page for NW_004624733.1 (Scaffold)

Potential Gene Matches

The following genes have been identified as possible homologs of the naked mole-rat gene and compared to it.

ATOX1 ENSCPOG00000026042 (Guinea pig)

Gene Details

antioxidant 1 copper chaperone

External Links

Gene Match (Ensembl Protein ID: ENSCPOP00000014765, Guinea pig)

Protein Percentage 92.19%
CDS Percentage 86.46%
Ka/Ks Ratio 0.05691 (Ka = 0.0489, Ks = 0.8602)

ATOX1 ENSG00000177556 (Human)

Gene Details

antioxidant 1 copper chaperone

External Links

Gene Match (Ensembl Protein ID: ENSP00000430598, Human)

Protein Percentage 80.88%
CDS Percentage 83.33%
Ka/Ks Ratio 0.13363 (Ka = 0.0925, Ks = 0.6924)

Atox1 ENSMUSG00000018585 (Mouse)

Gene Details

ATX1 (antioxidant protein 1) homolog 1 (yeast)

External Links

Gene Match (Ensembl Protein ID: ENSMUSP00000104485, Mouse)

Protein Percentage 91.18%
CDS Percentage 86.76%
Ka/Ks Ratio 0.06042 (Ka = 0.0461, Ks = 0.7623)

Atox1 ENSRNOG00000013118 (Rat)

Gene Details

antioxidant 1 copper chaperone (Atox1), mRNA

External Links

Gene Match (Ensembl Protein ID: ENSRNOP00000017588, Rat)

Protein Percentage 89.71%
CDS Percentage 84.31%
Ka/Ks Ratio 0.05696 (Ka = 0.0539, Ks = 0.9463)

Genome Location

Sequence Coding sequence

Length: 207 bp    Location: 37295255..37310229   Strand: +
>XM_004836547.1
ATGCCGAAGCACGAATTCTCCGTGGACATGACCTGCGGAGGCTGCGCGGAGGCGGTCTCTCGCGTGCTCAGCAAGCTGGGAGGAGTTGAGTTCAACATTGACCTGCCCAGCAAGAAGGTTTCCATCGACTCTGAGCACAGTGTGGACACCCTGCTGGCAACCCTGAATAAAACGGGAAAGGCTGTTTCCTATGTGGGCCCCAAGTAG

Related Sequences

XP_004836604.1 Protein

Atox1 PREDICTED: copper transport protein ATOX1 [Heterocephalus glaber]

Length: 68 aa      View alignments
>XP_004836604.1
MPKHEFSVDMTCGGCAEAVSRVLSKLGGVEFNIDLPSKKVSIDSEHSVDTLLATLNKTGKAVSYVGPK