Details from NCBI annotation

Gene Symbol Dbi
Gene Name diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein), transcript variant X4
Entrez Gene ID 101705205

Database interlinks

Part of NW_004624732.1 (Scaffold)

For more information consult the page for NW_004624732.1 (Scaffold)

Potential Gene Matches

The following genes have been identified as possible homologs of the naked mole-rat gene and compared to it.

DBI ENSCPOG00000000415 (Guinea pig)

Gene Details

diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein)

External Links

Gene Match (Ensembl Protein ID: ENSCPOP00000000366, Guinea pig)

Protein Percentage 95.24%
CDS Percentage 94.44%
Ka/Ks Ratio 0.15188 (Ka = 0.0238, Ks = 0.1567)

DBI ENSG00000155368 (Human)

Gene Details

diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein)

External Links

Gene Match (Ensembl Protein ID: ENSP00000440698, Human)

Protein Percentage 81.61%
CDS Percentage 85.44%
Ka/Ks Ratio 0.21959 (Ka = 0.1019, Ks = 0.4642)

Dbi ENSMUSG00000026385 (Mouse)

Gene Details

diazepam binding inhibitor

External Links

Gene Match (Ensembl Protein ID: ENSMUSP00000114705, Mouse)

Protein Percentage 78.16%
CDS Percentage 82.76%
Ka/Ks Ratio 0.14112 (Ka = 0.1071, Ks = 0.7587)

Genome Location

Sequence Coding sequence

Length: 264 bp    Location: 25769420..25764260   Strand: -
>XM_004836062.1
ATGTCTCAGGCTGAGTTTGAGAAAGCTGCTGAGGAGGTTAAGCACCTCAAGACCCAGCCAGCGGACCAAGAGATGTTGTTCATTTACAGCCACTACAAACAAGCCACTGTGGGCGACATAAATACAGAGCGGCCTGGAATGTTGGACCTCAAAGGGAAAGCTAAGTGGGATGCCTGGAACCAACTGAAAGGGACTTCCAAGGAAAGTGCCATGAAAGCTTACATCGACAAAGTAGAAGAGCTAAAGAACAAACACGGAATGTAA

Related Sequences

XP_004836119.1 Protein

Dbi PREDICTED: acyl-CoA-binding protein isoform X4 [Heterocephalus glaber]

Length: 87 aa      View alignments
>XP_004836119.1
MSQAEFEKAAEEVKHLKTQPADQEMLFIYSHYKQATVGDINTERPGMLDLKGKAKWDAWNQLKGTSKESAMKAYIDKVEELKNKHGM