Details from NCBI annotation

Gene Symbol Sptssa
Gene Name serine palmitoyltransferase, small subunit A
Entrez Gene ID 101717417

Database interlinks

Part of NW_004624838.1 (Scaffold)

For more information consult the page for NW_004624838.1 (Scaffold)

Potential Gene Matches

The following genes have been identified as possible homologs of the naked mole-rat gene and compared to it.

SPTSSA ENSCPOG00000027545 (Guinea pig)

Gene Details

serine palmitoyltransferase, small subunit A

External Links

Gene Match (Ensembl Protein ID: ENSCPOP00000016123, Guinea pig)

Protein Percentage 97.18%
CDS Percentage 94.37%
Ka/Ks Ratio 0.04046 (Ka = 0.0128, Ks = 0.3161)

SPTSSA ENSG00000165389 (Human)

Gene Details

serine palmitoyltransferase, small subunit A

External Links

Gene Match (Ensembl Protein ID: ENSP00000298130, Human)

Protein Percentage 94.37%
CDS Percentage 93.43%
Ka/Ks Ratio 0.07177 (Ka = 0.0246, Ks = 0.3422)

Sptssa ENSMUSG00000044408 (Mouse)

Gene Details

serine palmitoyltransferase, small subunit A

External Links

Gene Match (Ensembl Protein ID: ENSMUSP00000053671, Mouse)

Protein Percentage 95.77%
CDS Percentage 89.67%
Ka/Ks Ratio 0.01967 (Ka = 0.0175, Ks = 0.889)

Sptssa ENSRNOG00000004292 (Rat)

Gene Details

serine palmitoyltransferase, small subunit A (Sptssa), mRNA

External Links

Gene Match (Ensembl Protein ID: ENSRNOP00000005825, Rat)

Protein Percentage 95.77%
CDS Percentage 89.67%
Ka/Ks Ratio 0.02115 (Ka = 0.018, Ks = 0.8502)

Genome Location

Sequence Coding sequence

Length: 216 bp    Location: 2207021..2231838   Strand: +
>XM_004867575.1
ATGGCGGGAATGGCGTTGGCGCGGGCCTGGAAGCGGATGTCCTGGTTCTACTACCAGTACCTGCTGGTCACGGCGCTCTACATGCTGGAGCCCTGGGAGCGGACGGTGTTCAATTCCATGTTGATTTCCGTCATGGGCATGGCGCTCTACACTGGATACGTCTTCATGCCCCAGCACATCATGGCAATATTGCACTACTTTGAAATTGTACAATGA

Related Sequences

XP_004867632.1 Protein

Sptssa PREDICTED: serine palmitoyltransferase small subunit A [Heterocephalus glaber]

Length: 71 aa      View alignments
>XP_004867632.1
MAGMALARAWKRMSWFYYQYLLVTALYMLEPWERTVFNSMLISVMGMALYTGYVFMPQHIMAILHYFEIVQ